A0A5P1EML2 · A0A5P1EML2_ASPOF
- ProteinRBR-type E3 ubiquitin transferase
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids526 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.
Catalytic activity
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | ubiquitin ligase complex | |
Molecular Function | nucleic acid binding | |
Molecular Function | RNA-DNA hybrid ribonuclease activity | |
Molecular Function | ubiquitin conjugating enzyme binding | |
Molecular Function | ubiquitin protein ligase activity | |
Molecular Function | zinc ion binding | |
Biological Process | positive regulation of proteasomal ubiquitin-dependent protein catabolic process | |
Biological Process | protein polyubiquitination | |
Biological Process | ubiquitin-dependent protein catabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRBR-type E3 ubiquitin transferase
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Asparagales > Asparagaceae > Asparagoideae > Asparagus
Accessions
- Primary accessionA0A5P1EML2
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-60 | Disordered | ||||
Sequence: MGSHHDDVEEEFRSCCEDEEWQDTEECLAELLSSDEEVEEDADDDDDDDGASSGESEDED | ||||||
Compositional bias | 12-56 | Acidic residues | ||||
Sequence: FRSCCEDEEWQDTEECLAELLSSDEEVEEDADDDDDDDGASSGES | ||||||
Domain | 203-422 | RING-type | ||||
Sequence: SINQCLVCCCEEKQQSQIIKLKCSHSFCLNCMIVHVEGKLQALQVPIKCPQVRCKYHISKNAFKSFLPISCYQSLERATMEAKVLNLDRVYCPFPDCSVLFSPGQHSASRASSSNQYEINCVECQECCRLLCSSCGVPWHSSMSCEEYQSLSVEERDAGDANLLRLAQNNNWRRCQQCRRMVELTQGCFRVTCWCGHEFCYSCSAGYHSGTQTCQCTFWG | ||||||
Domain | 207-255 | RING-type | ||||
Sequence: CLVCCCEEKQQSQIIKLKCSHSFCLNCMIVHVEGKLQALQVPIKCPQVR |
Sequence similarities
Belongs to the RBR family. Ariadne subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length526
- Mass (Da)59,101
- Last updated2020-02-26 v1
- Checksum50B44DF8899575A5
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 12-56 | Acidic residues | ||||
Sequence: FRSCCEDEEWQDTEECLAELLSSDEEVEEDADDDDDDDGASSGES |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CM007386 EMBL· GenBank· DDBJ | ONK65791.1 EMBL· GenBank· DDBJ | Genomic DNA |