A0A419ISU0 · A0A419ISU0_SALET
- ProteinCatabolite activator protein
- Genecrp
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids210 (go to sequence)
- Protein existencePredicted
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity |
Names & Taxonomy
Protein names
- Recommended nameCatabolite activator protein
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Salmonella
Accessions
- Primary accessionA0A419ISU0
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 24-124 | Cyclic nucleotide-binding | ||||
Sequence: YPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSSQMARR | ||||||
Domain | 138-210 | HTH crp-type | ||||
Sequence: LDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length210
- Mass (Da)23,656
- Last updated2019-05-08 v1
- ChecksumC54244E974D53A0F
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AAGQRD010000029 EMBL· GenBank· DDBJ | EBQ9525841.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAGVIB010000052 EMBL· GenBank· DDBJ | EBS3655621.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAGVLN010000005 EMBL· GenBank· DDBJ | EBS4262909.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAHHJZ010000078 EMBL· GenBank· DDBJ | EBW6077123.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAHSXG010000002 EMBL· GenBank· DDBJ | EBZ9889922.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAKLNN010000018 EMBL· GenBank· DDBJ | ECT0472639.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAKZJA010000037 EMBL· GenBank· DDBJ | ECX1009401.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAMFGU010000032 EMBL· GenBank· DDBJ | EDG7674497.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAMKLV010000029 EMBL· GenBank· DDBJ | EDI2983467.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAMLPG010000026 EMBL· GenBank· DDBJ | EDI6266868.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAMKUP010000038 EMBL· GenBank· DDBJ | EDJ2077506.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAMKUI010000030 EMBL· GenBank· DDBJ | EDJ2123006.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DAAHGB010000023 EMBL· GenBank· DDBJ | HAB5960561.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DAAMIQ010000003 EMBL· GenBank· DDBJ | HAC6800901.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DAARXV010000031 EMBL· GenBank· DDBJ | HAE4392756.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DAASYI010000020 EMBL· GenBank· DDBJ | HAE7501502.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
QZFO01000013 EMBL· GenBank· DDBJ | RJR13212.1 EMBL· GenBank· DDBJ | Genomic DNA |