A0A3U8JL27 · A0A3U8JL27_SALMO
- Protein4Fe-4S dicluster domain-containing protein
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids185 (go to sequence)
- Protein existencePredicted
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | iron-sulfur cluster binding | |
Molecular Function | metal ion binding |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Salmonella
Accessions
- Primary accessionA0A3U8JL27
Proteomes
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 3-33 | 4Fe-4S ferredoxin-type | ||||
Sequence: RAFLVNSDKCIGCRGCAMACKSFNQLEPDRF | ||||||
Domain | 48-79 | 4Fe-4S ferredoxin-type | ||||
Sequence: EERAFYSLACNHCEHPACVAACPVEAYTKRED | ||||||
Domain | 80-109 | 4Fe-4S ferredoxin-type | ||||
Sequence: GVVVHNPERCIGCKNCIRNCPYGAPRFNEE |
Family and domain databases
Sequence
- Sequence statusComplete
- Length185
- Mass (Da)20,903
- Last updated2019-07-31 v1
- Checksum4DD3E788970FBEE1
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AAGEDJ010000008 EMBL· GenBank· DDBJ | EBM9176598.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAGJVW010000018 EMBL· GenBank· DDBJ | EBO8587899.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAHYIA010000020 EMBL· GenBank· DDBJ | ECB6708637.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAKKUG010000009 EMBL· GenBank· DDBJ | ECS9000718.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAKLCW010000018 EMBL· GenBank· DDBJ | ECS9168476.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAKMKW010000023 EMBL· GenBank· DDBJ | ECT3327173.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAKSUE010000009 EMBL· GenBank· DDBJ | ECV0719717.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAKSJB010000018 EMBL· GenBank· DDBJ | ECV2333717.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAKSCW010000009 EMBL· GenBank· DDBJ | ECV3150299.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAKUXP010000010 EMBL· GenBank· DDBJ | ECV9756654.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAKXFP010000010 EMBL· GenBank· DDBJ | ECW6426328.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAKYVF010000020 EMBL· GenBank· DDBJ | ECX1555721.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AALCUX010000014 EMBL· GenBank· DDBJ | ECY3345969.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AALEDO010000003 EMBL· GenBank· DDBJ | ECY6786589.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AALGFK010000017 EMBL· GenBank· DDBJ | ECY9607318.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AALGYR010000007 EMBL· GenBank· DDBJ | ECZ5261915.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AALHUF010000012 EMBL· GenBank· DDBJ | ECZ7804555.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AALIOX010000009 EMBL· GenBank· DDBJ | EDA0011580.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AALNLT010000023 EMBL· GenBank· DDBJ | EDB4301015.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AALRRW010000015 EMBL· GenBank· DDBJ | EDC6721136.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AAMCZA010000012 EMBL· GenBank· DDBJ | EDG0897559.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DAAQUD010000011 EMBL· GenBank· DDBJ | HAE0881960.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DAARLW010000014 EMBL· GenBank· DDBJ | HAE2973029.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DAARUM010000017 EMBL· GenBank· DDBJ | HAE3987393.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DAATOZ010000010 EMBL· GenBank· DDBJ | HAE8948362.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
SRBT01000013 EMBL· GenBank· DDBJ | KAA7149120.1 EMBL· GenBank· DDBJ | Genomic DNA |