A0A318D377 · A0A318D377_9GAMM
- ProteinUDP-2,3-diacylglucosamine hydrolase
- GenelpxH
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids239 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Hydrolyzes the pyrophosphate bond of UDP-2,3-diacylglucosamine to yield 2,3-diacylglucosamine 1-phosphate (lipid X) and UMP by catalyzing the attack of water at the alpha-P atom. Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell.
Catalytic activity
- UDP-2-N,3-O-bis[(3R)-3-hydroxytetradecanoyl]-alpha-D-glucosamine + H2O = 2-N,3-O-bis[(3R)-3-hydroxytetradecanoyl]-alpha-D-glucosaminyl 1-phosphate + UMP + 2 H+
Cofactor
Note: Binds 2 Mn2+ ions per subunit in a binuclear metal center.
Pathway
Glycolipid biosynthesis; lipid IV(A) biosynthesis; lipid IV(A) from (3R)-3-hydroxytetradecanoyl-[acyl-carrier-protein] and UDP-N-acetyl-alpha-D-glucosamine: step 4/6.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 7 | Mn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 9 | Mn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 40 | Mn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 40 | Mn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 78 | Mn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 78-79 | substrate | ||||
Sequence: NR | ||||||
Binding site | 113 | Mn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 121 | substrate | ||||
Sequence: D | ||||||
Binding site | 159 | substrate | ||||
Sequence: S | ||||||
Binding site | 163 | substrate | ||||
Sequence: Q | ||||||
Binding site | 166 | substrate | ||||
Sequence: K | ||||||
Binding site | 194 | Mn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 194 | substrate | ||||
Sequence: H | ||||||
Binding site | 196 | Mn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | extrinsic component of plasma membrane | |
Molecular Function | manganese ion binding | |
Molecular Function | UDP-2,3-diacylglucosamine hydrolase activity | |
Biological Process | lipid A biosynthetic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameUDP-2,3-diacylglucosamine hydrolase
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Kangiellales > Kangiellaceae > Kangiella
Accessions
- Primary accessionA0A318D377
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cell inner membrane ; Peripheral membrane protein
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 2-198 | Calcineurin-like phosphoesterase | ||||
Sequence: IHIISDLHLCEERPDLTALFEHFMDEIAPQSEALYVLGDLYESWIGDDDDSAFVESTIQKFKAYSDSGKKLYFQHGNRDFLLGDSFAQKTGGELLDEVHSIQLGDKKAIMMHGDSLCWDDKEYMQFREIVRSEQWQQQLLSQPLEVRRGIAADLRAKSRQAQENKASAITDVHPQAVEEVLQKSDAKILIHGHTHRP |
Sequence similarities
Belongs to the LpxH family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length239
- Mass (Da)27,444
- Last updated2018-10-10 v1
- ChecksumF1ED970D4DA89B9C