A0A2U8JGK6 · A0A2U8JGK6_DUNTE
- ProteinATP citrate synthase
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids426 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
Catalytic activity
- acetyl-CoA + ADP + oxaloacetate + phosphate = ATP + citrate + CoA
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | ATP citrate synthase activity | |
Molecular Function | nucleotide binding | |
Biological Process | acetyl-CoA biosynthetic process | |
Biological Process | fatty acid biosynthetic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameATP citrate synthase
- EC number
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Chlorophyta > core chlorophytes > Chlorophyceae > CS clade > Chlamydomonadales > Dunaliellaceae > Dunaliella
Accessions
- Primary accessionA0A2U8JGK6
Subcellular Location
Interaction
Subunit
Heterooctamer of 4 alpha and 4 beta chains.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 7-203 | ATP-grasp fold succinyl-CoA synthetase-type | ||||
Sequence: REYDAKRILKARFEGVIGKTLPIQVAQVTSSTDYKDLLQQHPWLGSSKLVVKPDMLFGQRGKHDLVGLNLSWSQAEAFVKERIGKTVTVNECTGPVTTFIVEPFMPHKEEMYMCIQSNRLDYEVSFSAMGGVSIEEHWDQLSSIKVDATAQDLSSEAVAPLTAKLPLETRGRVGDFIRAMFKVFLDVDATLIEMNPF | ||||||
Domain | 243-419 | ATP-citrate synthase citrate-binding | ||||
Sequence: RTLAPAEEHVQSMDETTGASLKFTVLNPKGRVWLMVAGGGASVIYTDTVGDLGFAQELGNYGEYSGAPNTNETYQYARTVLSCATANSDGRARALLIGGGIANFTNVAATFQGIIKALRESSEALIAAKVFTFVRRGGPNYLEGLDMMRALGSEIGVPIEVYGPESSMTGICANAIE |
Sequence similarities
Belongs to the succinate/malate CoA ligase beta subunit family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length426
- Mass (Da)46,679
- Last updated2018-09-12 v1
- Checksum16B168329685C781