A0A2H4WZK4 · A0A2H4WZK4_9GENT
- ProteinCytochrome c oxidase subunit 3
- Genecox3
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids265 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Cellular Component | mitochondrion | |
Molecular Function | cytochrome-c oxidase activity | |
Biological Process | mitochondrial electron transport, cytochrome c to oxygen |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameCytochrome c oxidase subunit 3
Gene names
Encoded on
- Mitochondrion
Organism names
- Organism
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > asterids > lamiids > Gentianales > Rubiaceae > Rubioideae > Rubieae > Rubia
Accessions
- Primary accessionA0A2H4WZK4
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 43-61 | Helical | ||||
Sequence: ATLLSFGLIFILYTMFVWW | ||||||
Transmembrane | 81-103 | Helical | ||||
Sequence: GPRYGFLLFIVSEVMFFFALFWA | ||||||
Transmembrane | 162-180 | Helical | ||||
Sequence: AVYALVVTVLLALVFTGFQ | ||||||
Transmembrane | 200-223 | Helical | ||||
Sequence: FFLATGFHGFHVIIGTLFLIICGI | ||||||
Transmembrane | 243-263 | Helical | ||||
Sequence: WYWHFVDVVWLFLFVSIYWWG |
Keywords
- Cellular component
Interaction
Subunit
Component of the cytochrome c oxidase (complex IV, CIV), a multisubunit enzyme composed of a catalytic core of 3 subunits and several supernumerary subunits. The complex exists as a monomer or a dimer and forms supercomplexes (SCs) in the inner mitochondrial membrane with ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII).
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 5-264 | Heme-copper oxidase subunit III family profile | ||||
Sequence: QRHSYHLVDPSPWPISGSLGALATTVGGVMYMHSFQGGATLLSFGLIFILYTMFVWWRDVLRESTLEGHHTKVVQLGPRYGFLLFIVSEVMFFFALFWASSHSSLAPTVEIGGIWPPKGIEVLDPWEIPFLNTLIPLSSGAAVTWAHHAILAGKEKRAVYALVVTVLLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWHFVDVVWLFLFVSIYWWGG |
Sequence similarities
Belongs to the cytochrome c oxidase subunit 3 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length265
- Mass (Da)29,812
- Last updated2018-02-28 v1
- Checksum9EFBBD893E1EECC4