A0A1U7M093 · A0A1U7M093_9FIRM
- ProteinGlycerol kinase
- GeneglpK
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids495 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Key enzyme in the regulation of glycerol uptake and metabolism. Catalyzes the phosphorylation of glycerol to yield sn-glycerol 3-phosphate.
Catalytic activity
- glycerol + ATP = sn-glycerol 3-phosphate + ADP + H+
Activity regulation
Activated by phosphorylation and inhibited by fructose 1,6-bisphosphate (FBP).
Pathway
Polyol metabolism; glycerol degradation via glycerol kinase pathway; sn-glycerol 3-phosphate from glycerol: step 1/1.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 11 | ADP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 11 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 11 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 12 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 13 | ATP (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 15 | ADP (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 81 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 81 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 82 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 82 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 133 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 133 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 242 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 242 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 243 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 264 | ADP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 264 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 307 | ADP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 307 | ATP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 408 | ADP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 408 | ATP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 412 | ADP (UniProtKB | ChEBI) | ||||
Sequence: N |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | ATP binding | |
Molecular Function | glycerol kinase activity | |
Biological Process | glycerol catabolic process | |
Biological Process | glycerol-3-phosphate metabolic process | |
Biological Process | phosphorylation |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGlycerol kinase
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageBacteria > Bacillota > Tissierellia > Tissierellales > Peptoniphilaceae > Peptoniphilus
Accessions
- Primary accessionA0A1U7M093
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 3-249 | Carbohydrate kinase FGGY N-terminal | ||||
Sequence: YIMAFDAGTTSARTIIFDKKGNPVSVAQKELIKHFPKPGYVEEEPEDLWSKQIGTAVEAMSKKGIDPKDIAAIGITNQRETTIVWNKKTMEPVYNAIVWQCKRTTKYCEELKERGLEEKIKQKTGLVIDPYFSATKIRWILENVEGAREMANRGELLFGTVETYLIYKLTDGEVHITDYTNASRTMLFNIKEKRWDDELLEIFDIPRSMLPEIKNSSEVYGNSKSKYLGCEIPIASAIGDQQSSLFG | ||||||
Domain | 259-447 | Carbohydrate kinase FGGY C-terminal | ||||
Sequence: KSTYGTGAFILMNTGDELIRSQNGLVSTIAWSINGKVKYALEGSIFEAGSCINFLRDNLRIIDQADDSEYMASKVKDTNDCYFIPAFTGLGAPYWDQYARGSIIGLTGSVNKYHIIRAALESIAYLSCDVVEAMQEDSMTKIKSLKVDGGVSKNNFLMQFLSDIVGVEVIRPKVIELTALGACYMAGLA |
Sequence similarities
Belongs to the FGGY kinase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length495
- Mass (Da)55,838
- Last updated2017-05-10 v1
- ChecksumEC24CE1780D7AF2F