A0A1L9VG80 · A0A1L9VG80_ASPGL
- ProteinCCHC-type domain-containing protein
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids608 (go to sequence)
- Protein existencePredicted
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | TRAMP complex | |
Molecular Function | RNA binding | |
Molecular Function | zinc ion binding | |
Biological Process | nuclear mRNA surveillance of mRNA 3'-end processing | |
Biological Process | nuclear polyadenylation-dependent CUT catabolic process | |
Biological Process | nuclear polyadenylation-dependent rRNA catabolic process | |
Biological Process | nuclear polyadenylation-dependent snoRNA catabolic process | |
Biological Process | nuclear polyadenylation-dependent snRNA catabolic process | |
Biological Process | TRAMP-dependent tRNA surveillance pathway |
Names & Taxonomy
Protein names
- Recommended nameCCHC-type domain-containing protein
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Opisthokonta > Fungi > Dikarya > Ascomycota (ascomycetes) > saccharomyceta > Pezizomycotina (filamentous ascomycetes) > leotiomyceta > Eurotiomycetes > Eurotiomycetidae > Eurotiales (green and blue molds) > Aspergillaceae > Aspergillus > Aspergillus subgen. Aspergillus > Aspergillus glaucus
Accessions
- Primary accessionA0A1L9VG80
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-25 | Polar residues | ||||
Sequence: MPGSSEEENDSRTASVGLQRTRVQN | ||||||
Region | 1-197 | Disordered | ||||
Sequence: MPGSSEEENDSRTASVGLQRTRVQNQDSHPNKRQRRTRGNSANSDVRDFVPQGGTFSAKPLEVDQDDTSSSGSDSDSGSNWSDANPNPYAGTTSQAVNWNQGNKRAIRTTLGGRGKANNNKKPEPQPQPEPEKESDAQFDAVNGAYWRSRSESVSTGNGDNDKKDEGQDLEEGEVNEDAPALDTSGDSDDSESLDSE | ||||||
Compositional bias | 26-42 | Basic and acidic residues | ||||
Sequence: QDSHPNKRQRRTRGNSA | ||||||
Compositional bias | 62-107 | Polar residues | ||||
Sequence: EVDQDDTSSSGSDSDSGSNWSDANPNPYAGTTSQAVNWNQGNKRAI | ||||||
Compositional bias | 171-197 | Acidic residues | ||||
Sequence: EEGEVNEDAPALDTSGDSDDSESLDSE | ||||||
Domain | 300-316 | CCHC-type | ||||
Sequence: SCTECMQEGHIAQVCPS | ||||||
Domain | 338-354 | CCHC-type | ||||
Sequence: RCQRCRERGHDEAQCSS | ||||||
Domain | 364-380 | CCHC-type | ||||
Sequence: PCDLCGSQDHLELDCDY | ||||||
Domain | 399-415 | CCHC-type | ||||
Sequence: SCSRCTSNNHLAGDCPS | ||||||
Region | 437-608 | Disordered | ||||
Sequence: NINSVIPGRSRPGPVARGRGGMKIRGRAERSPTPDSDEDDGIFTRPNQRPPPPGRGGGRGNIRIGGGIGRGKNLGPGGYRDRNDSFGDRSRQRSLSPIGRPGPGPGRGRGARDNWNVRSRSPPRRGRPPPPPSRGGRGRGGGGGGGKRGGGGGDAYRPMPSAAKKNWDRYRF | ||||||
Compositional bias | 458-480 | Basic and acidic residues | ||||
Sequence: MKIRGRAERSPTPDSDEDDGIFT |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length608
- Mass (Da)65,921
- Last updated2017-03-15 v1
- Checksum32E5C9165E746051
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-25 | Polar residues | ||||
Sequence: MPGSSEEENDSRTASVGLQRTRVQN | ||||||
Compositional bias | 26-42 | Basic and acidic residues | ||||
Sequence: QDSHPNKRQRRTRGNSA | ||||||
Compositional bias | 62-107 | Polar residues | ||||
Sequence: EVDQDDTSSSGSDSDSGSNWSDANPNPYAGTTSQAVNWNQGNKRAI | ||||||
Compositional bias | 171-197 | Acidic residues | ||||
Sequence: EEGEVNEDAPALDTSGDSDDSESLDSE | ||||||
Compositional bias | 458-480 | Basic and acidic residues | ||||
Sequence: MKIRGRAERSPTPDSDEDDGIFT |
Keywords
- Technical term