A0A131XD71 · A0A131XD71_9ACAR

  • Protein
    Methylosome subunit pICln
  • Status
    UniProtKB unreviewed (TrEMBL)
  • Amino acids
  • Protein existence
    Evidence at transcript level
  • Annotation score
    2/5

Function

function

Involved in both the assembly of spliceosomal snRNPs and the methylation of Sm proteins. Chaperone that regulates the assembly of spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome, and thereby plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP (Sm core). In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus.

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentcytosol
Cellular Componentmethylosome
Cellular ComponentpICln-Sm protein complex
Cellular Componentplasma membrane
Cellular Componentspliceosomal complex
Biological Processcell volume homeostasis
Biological Processchloride transport
Biological ProcessmRNA cis splicing, via spliceosome
Biological Processspliceosomal snRNP assembly

Names & Taxonomy

Protein names

  • Recommended name
    Methylosome subunit pICln

Organism names

  • Taxonomic identifier
  • Organism
  • Strain
    • Samish
  • Taxonomic lineage
    Eukaryota > Metazoa > Ecdysozoa > Arthropoda > Chelicerata > Arachnida > Acari > Parasitiformes > Ixodida > Ixodoidea > Ixodidae > Hyalomminae > Hyalomma

Accessions

  • Primary accession
    A0A131XD71

Subcellular Location

Keywords

Family & Domains

Features

Showing features for region, compositional bias.

TypeIDPosition(s)Description
Region85-108Disordered
Region124-201Disordered
Compositional bias137-156Acidic residues
Compositional bias176-193Acidic residues

Sequence similarities

Belongs to the pICln (TC 1.A.47) family.

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    201
  • Mass (Da)
    22,176
  • Last updated
    2016-05-11 v1
  • Checksum
    805425F6D263E72D
MVILTSFPPPDEGIRHREEATAAYIQSRDLGKGTLYIAESRVSWVGQDSSGFSLEYPSVALHALSRDLRAFPEECLYLMIDGDLGEGEEESSENGQDDEQPASEIRFVPDDKSHLEAMYKAMSECQALHPDPADVGDSDDDGVYEDADEDDEGAEYDVRAAEQQRGCHQLEADAGNGDWEAEEPGDEPMETGQFEDAEPDH

Features

Showing features for compositional bias.

TypeIDPosition(s)Description
Compositional bias137-156Acidic residues
Compositional bias176-193Acidic residues

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
GEFH01004541
EMBL· GenBank· DDBJ
JAP64040.1
EMBL· GenBank· DDBJ
mRNA

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp