A0A0S0ZIK9 · A0A0S0ZIK9_9ASTE
- ProteinCytochrome b6
- GenepetB
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids213 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Cofactor
Protein has several cofactor binding sites:
Note: Binds 2 heme b groups non-covalently with two histidine residues as axial ligands.
Note: Binds one heme group covalently by a single cysteine link with no axial amino acid ligand.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast thylakoid membrane | |
Molecular Function | electron transfer activity | |
Molecular Function | metal ion binding | |
Molecular Function | oxidoreductase activity | |
Biological Process | photosynthesis | |
Biological Process | respiratory electron transport chain |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameCytochrome b6
Gene names
Encoded on
- Chloroplast
Organism names
- Organism
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > asterids > lamiids > Icacinales > Icacinaceae > Iodes
Accessions
- Primary accessionA0A0S0ZIK9
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Plastid, chloroplast thylakoid membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 29-56 | Helical | ||||
Sequence: NIFYCLGGITLTCFLVQVATGFAMTFYY | ||||||
Transmembrane | 86-104 | Helical | ||||
Sequence: WSASMMVLMMILHVFRVYL | ||||||
Transmembrane | 116-136 | Helical | ||||
Sequence: WVTGVVLAVLTASFGVTGYSL | ||||||
Transmembrane | 182-201 | Helical | ||||
Sequence: YSLHTFVLPLLTAVFMLMHF |
Keywords
- Cellular component
Interaction
Subunit
The 4 large subunits of the cytochrome b6-f complex are cytochrome b6, subunit IV (17 kDa polypeptide, PetD), cytochrome f and the Rieske protein, while the 4 small subunits are PetG, PetL, PetM and PetN. The complex functions as a dimer.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 2-213 | Cytochrome b/b6 N-terminal region profile | ||||
Sequence: VYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTITEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL |
Sequence similarities
Belongs to the cytochrome b family. PetB subfamily.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusFragment
- Length213
- Mass (Da)23,960
- Last updated2016-02-17 v1
- Checksum7F70765976540939
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: K | ||||||
Non-terminal residue | 213 | |||||
Sequence: L |