A0A0M4MDU6 · A0A0M4MDU6_9PEZI
- ProteinDNA-directed RNA polymerase
- GeneRPB2
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids289 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | RNA polymerase II, core complex | |
Molecular Function | DNA binding | |
Molecular Function | ribonucleoside binding | |
Molecular Function | RNA polymerase II activity |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDNA-directed RNA polymerase
- EC number
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Sordariomycetes > Xylariomycetidae > Xylariales > Diatrypaceae > Cryptosphaeria
Accessions
- Primary accessionA0A0M4MDU6
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 2-288 | DNA-directed RNA polymerase subunit 2 hybrid-binding | ||||
Sequence: LYYPQKPLGTTRSMEFLKFRELPAGQNAIVAIACYSGYNQEDSVIMNQSSIDRGLFRSLFFRSYSDCEKRIGINTIETFEKPFRADTLRLKQGTYDKLDDDGIIAPGIRVSGEDIIIGKTSPINPENEEMGQRTKVHVKRDASTPLRSTESGIIDSVVVTTNADGLRYVKVRVRTTKIPQIGDKFASRHGQKGTIGVTYRQEDMPFTREGITPDIIINPHAIPSRMTIAHLIECLLSKVSTLKGMEGDATPFTDVTVDSVSNLLREHGYQSRGFEIMYHGHTGRKLR |
Sequence similarities
Belongs to the RNA polymerase beta chain family.
Family and domain databases
Sequence
- Sequence statusFragment
- Length289
- Mass (Da)32,390
- Last updated2015-12-09 v1
- Checksum2C4815B81C3052F1
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: I | ||||||
Non-terminal residue | 289 | |||||
Sequence: S |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KT425306 EMBL· GenBank· DDBJ | ALE27965.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT425307 EMBL· GenBank· DDBJ | ALE27966.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT425308 EMBL· GenBank· DDBJ | ALE27967.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT425309 EMBL· GenBank· DDBJ | ALE27968.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT425310 EMBL· GenBank· DDBJ | ALE27969.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT425311 EMBL· GenBank· DDBJ | ALE27970.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT425312 EMBL· GenBank· DDBJ | ALE27971.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT425313 EMBL· GenBank· DDBJ | ALE27972.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT425314 EMBL· GenBank· DDBJ | ALE27973.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT425315 EMBL· GenBank· DDBJ | ALE27974.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT425316 EMBL· GenBank· DDBJ | ALE27975.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT425317 EMBL· GenBank· DDBJ | ALE27976.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT425318 EMBL· GenBank· DDBJ | ALE27977.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT425366 EMBL· GenBank· DDBJ | ALE28025.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT425367 EMBL· GenBank· DDBJ | ALE28026.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT425368 EMBL· GenBank· DDBJ | ALE28027.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT425369 EMBL· GenBank· DDBJ | ALE28028.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT425370 EMBL· GenBank· DDBJ | ALE28029.1 EMBL· GenBank· DDBJ | Genomic DNA |