A0A0B4MR67 · A0A0B4MR67_9APIA
- ProteinATP synthase epsilon chain, chloroplastic
- GeneatpE
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids140 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Produces ATP from ADP in the presence of a proton gradient across the membrane.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | proton-transporting ATP synthase complex, catalytic core F(1) | |
Molecular Function | ATP binding | |
Molecular Function | proton-transporting ATP synthase activity, rotational mechanism |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameATP synthase epsilon chain, chloroplastic
- Alternative names
Gene names
Encoded on
- Chloroplast
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > asterids > campanulids > Apiales > Araliaceae > Panax
Accessions
- Primary accessionA0A0B4MR67
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Peripheral membrane protein
Plastid, chloroplast thylakoid membrane ; Peripheral membrane protein
Keywords
- Cellular component
Interaction
Subunit
F-type ATPases have 2 components, CF1 - the catalytic core - and CF0 - the membrane proton channel. CF1 has five subunits: alpha3, beta3, gamma1, delta1, epsilon1. CF0 has three main subunits: a, b and c.
Structure
Family & Domains
Features
Showing features for domain, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 3-81 | ATP synthase F1 complex delta/epsilon subunit N-terminal | ||||
Sequence: LNLCVLTPNRTVWDSKVNEIILSTNNGQIGVLPDHASIATAVDIGILRIRLNDQWLTMALMGGFARIGNNEITVLVNDA | ||||||
Domain | 86-129 | ATP synthase epsilon subunit C-terminal | ||||
Sequence: DIDSQEAQQTLEIAEANLRKAEGKRQKIEANLALRRARTRVETI | ||||||
Coiled coil | 89-116 | |||||
Sequence: SQEAQQTLEIAEANLRKAEGKRQKIEAN |
Sequence similarities
Belongs to the ATPase epsilon chain family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length140
- Mass (Da)15,375
- Last updated2015-04-01 v1
- ChecksumCD5C69CC2393896B
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KJ566590 EMBL· GenBank· DDBJ | AIA24333.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KP036468 EMBL· GenBank· DDBJ | AKB99078.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KR021381 EMBL· GenBank· DDBJ | AKG26606.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT001509 EMBL· GenBank· DDBJ | AKU70781.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK408925 EMBL· GenBank· DDBJ | QDI95978.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK408927 EMBL· GenBank· DDBJ | QDI96152.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK408928 EMBL· GenBank· DDBJ | QDI96239.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK408931 EMBL· GenBank· DDBJ | QDI96502.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK408937 EMBL· GenBank· DDBJ | QDI97027.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK408945 EMBL· GenBank· DDBJ | QDI97726.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK408946 EMBL· GenBank· DDBJ | QDI97813.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK408954 EMBL· GenBank· DDBJ | QDI98514.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK408955 EMBL· GenBank· DDBJ | QDI98601.1 EMBL· GenBank· DDBJ | Genomic DNA |