A0A097KQ20 · A0A097KQ20_GEMMI
- ProteinPhotosystem I assembly protein Ycf3
- Geneycf3
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids167 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Seems to be required for the assembly of the photosystem I complex.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast thylakoid membrane | |
Biological Process | photosynthesis |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended namePhotosystem I assembly protein Ycf3
Gene names
Encoded on
- Chloroplast
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Chlorophyta > core chlorophytes > Trebouxiophyceae > Chlorellales > Chlorellaceae > Geminella
Accessions
- Primary accessionA0A097KQ20
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Peripheral membrane protein
Plastid, chloroplast thylakoid membrane ; Peripheral membrane protein
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 35-68 | TPR | ||||
Sequence: AFSYYRDGMSAQSEGEYAEALQNYYEAMRLEIDA | ||||||
Repeat | 35-68 | TPR 1 | ||||
Sequence: AFSYYRDGMSAQSEGEYAEALQNYYEAMRLEIDA | ||||||
Repeat | 72-105 | TPR | ||||
Sequence: SYILYNIGLIHTSNGEHGRALEYYYQALERNPSL | ||||||
Repeat | 72-105 | TPR 2 | ||||
Sequence: SYILYNIGLIHTSNGEHGRALEYYYQALERNPSL | ||||||
Repeat | 120-153 | TPR 3 | ||||
Sequence: GEQAIEKGEIEISKILFDKAADYWKEAIRLAPTN |
Sequence similarities
Belongs to the Ycf3 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length167
- Mass (Da)19,511
- Last updated2015-01-07 v1
- ChecksumCF48274CFDC2B48B
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KM462883 EMBL· GenBank· DDBJ | AIT95299.1 EMBL· GenBank· DDBJ | Genomic DNA |