A0A022R636 · A0A022R636_ERYGU
- ProteinSGNH hydrolase-type esterase domain-containing protein
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids365 (go to sequence)
- Protein existenceInferred from homology
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | hydrolase activity, acting on ester bonds |
Names & Taxonomy
Protein names
- Recommended nameSGNH hydrolase-type esterase domain-containing protein
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > asterids > lamiids > Lamiales > Phrymaceae > Erythranthe
Accessions
- Primary accessionA0A022R636
Proteomes
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-25 | |||||
Sequence: MESSNLSIFFFCCIFLISSGLIVEA | ||||||
Chain | PRO_5001504494 | 26-365 | SGNH hydrolase-type esterase domain-containing protein | |||
Sequence: QDSPHHHHRREKEETDDNGFRPAKLFVFGDSYADTGNVRKSLANSWKEPYGTTFPGKPAGRFSDGRVLTDYIAKFLGLKSPVAYRWMKLFGGKKLRNGVNFAYGGSGVFDTLANVLPNMTTQIDFLEKLINESVYTTLDLHSSVVLLSLAGNDYGAYLATGGTIQGLPSFIPLVINQLSINLKRLQKMGATKVIVTALEPLGCLPRFTGLSSYQQCNATRNLATNFHNLLLQQTVAKLNNDTNSSTFFILDLYNSFNTVLEQKGNPQGDLKFETPLKPCCMGISSEYFCGSVDEKGVKMYTVCSDPKSAFFWDSSHPTEAGWHAVYTTLKSSLGQLFQFS |
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length365
- Mass (Da)40,407
- Last updated2014-06-11 v1
- Checksum8E6ABF3F6B96601D
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KI630617 EMBL· GenBank· DDBJ | EYU35459.1 EMBL· GenBank· DDBJ | Genomic DNA |